PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g095460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 454aa    MW: 50928.4 Da    PI: 6.7935
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g095460.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS420.71.2e-128454531374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar...svselykalppsetseknsseelaal........... 81 
                     l++lL+++A++vs++++++aq+lL+ ls ++sp+gd+++Rl++ ft+AL+ r++r   +++ +++a ++ +++e+++ ++ + +           
  Csa17g095460.1  45 LRRLLFTAADFVSQSNFTAAQNLLSILSLNSSPYGDSTERLVHLFTKALSVRINRlqqEQDPTAEAAATCTANEMTMGNNSSTVftssvckeqfl 139
                     689***********************************************9999952233446666655555555533333333566789999** PP

            GRAS  82 ...............klfsevsPilkfshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgvgspesgsk 155
                                      +++++P+++f+hltaNqaIl+a+e++   ++Hi+D+disqGlQWp+L+qaLa+R+    ++ pslRiTg+g+    + 
  Csa17g095460.1 140 frtknnnsdfescyyLWLNQLTPFIRFGHLTANQAILDATETNdnGALHILDLDISQGLQWPPLMQALAERSsnpnSPRPSLRITGCGR----DV 230
                     ******99999876444************************9977899***********************987767789*********....9* PP

            GRAS 156 eeleetgerLakfAeelgvpfefnvl......vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
                       l++tg+rL++fA++lg++f+f++l      +a  l +++l +L++ +gE++aVn+v+ lh+++++++++     ++L+++ksl+P++v+++e+
  Csa17g095460.1 231 AGLNRTGDRLTRFANSLGLQFQFHTLviveedIAGLLLQIRLLALSFVHGETIAVNCVHFLHKFFNDDGDMIG---HFLSVIKSLNPRIVTMAER 322
                     *************************976332222233344666777888**********************99...******************* PP

            GRAS 245 eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                     ea+h+++sFl+rf+ea+++y+a+fdslea+lp++s+er ++E++++g+ei +vva+e +er++rh+++e W+e+++++GF +vp++++a +qakl
  Csa17g095460.1 323 EANHGDHSFLNRFSEAVDHYVAIFDSLEATLPPNSRERLTLEQRWFGKEIFDVVAAEARERKQRHRRFEIWEEMMKRFGFVNVPIGSFALSQAKL 417
                     *********************************************************************************************** PP

            GRAS 340 llrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     llr ++ s+gy+++  ++sl+lgW++r L+svS+W+
  Csa17g095460.1 418 LLRLHYpSEGYNLQFLNNSLFLGWQNRLLFSVSSWK 453
                     ***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.63719432IPR005202Transcription factor GRAS
PfamPF035144.2E-12645453IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010223Biological Processsecondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MLTSFKSSSS SSEDATATTT TENPPPFCQL ASSSSSASTS ASHHLRRLLF TAADFVSQSN  60
FTAAQNLLSI LSLNSSPYGD STERLVHLFT KALSVRINRL QQEQDPTAEA AATCTANEMT  120
MGNNSSTVFT SSVCKEQFLF RTKNNNSDFE SCYYLWLNQL TPFIRFGHLT ANQAILDATE  180
TNDNGALHIL DLDISQGLQW PPLMQALAER SSNPNSPRPS LRITGCGRDV AGLNRTGDRL  240
TRFANSLGLQ FQFHTLVIVE EDIAGLLLQI RLLALSFVHG ETIAVNCVHF LHKFFNDDGD  300
MIGHFLSVIK SLNPRIVTMA EREANHGDHS FLNRFSEAVD HYVAIFDSLE ATLPPNSRER  360
LTLEQRWFGK EIFDVVAAEA RERKQRHRRF EIWEEMMKRF GFVNVPIGSF ALSQAKLLLR  420
LHYPSEGYNL QFLNNSLFLG WQNRLLFSVS SWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-477945337375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3033490.0AJ303349.1 Capsella rubella ORF1, ORF2, ORF3, ORF4, ORF5 and ORF6 (partial).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010480099.10.0PREDICTED: scarecrow-like protein 18
SwissprotQ9ZWC50.0SCL18_ARATH; Scarecrow-like protein 18
TrEMBLD7KMZ60.0D7KMZ6_ARALL; Putative uncharacterized protein
STRINGAT1G55580.10.0(Arabidopsis thaliana)
STRINGscaffold_105352.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113292733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55580.10.0GRAS family protein